Fervidibacillus halotolerans: OE105_05930 Help Entry OE105_05930       CDS       T08855                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fhl  Fervidibacillus halotolerans Pathway fhl01100   Metabolic pathways fhl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fhl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OE105_05930    00074 Mycolic acid biosynthesis     OE105_05930   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OE105_05930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C FERM_N PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WAA13639 UniProt:  A0A9E8M1Q2 LinkDB All DBs Position complement(1262599..1262832) Genome browser AA seq 77 aa AA seqDB search MSDVFERVKNIIVERLGVEDEKVTMEATFKDDLGADSLDVVELVMELEDEFGLQFSDEDS EKIVTVGDAVKYIESKL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtatttgaacgagtaaaaaatattattgtcgaacgtctcggggtagaagat gaaaaagttacgatggaagcaacttttaaagatgacctcggtgccgattcgctcgatgtt gtagaacttgttatggaattagaagatgaattcggcttacaattttccgatgaggattct gaaaaaatcgttaccgtaggcgatgcggtaaaatacatagaaagtaagctgtaa

DBGET integrated database retrieval system