Candidatus Filomicrobium marinum W: BN1229_v1_2770 Help Entry BN1229_v1_2770    CDS       T03856                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism fil  Candidatus Filomicrobium marinum W Pathway fil01100   Metabolic pathways fil01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fil00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BN1229_v1_2770 (acpP)    00074 Mycolic acid biosynthesis     BN1229_v1_2770 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BN1229_v1_2770 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N TRI4_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  CFX37187 UniProt:  A0A0D6JI87 LinkDB All DBs Position 1:2701378..2701620 Genome browser AA seq 80 aa AA seqDB search MSDVAERVKKIVVEHLGVEADKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EHILTVGDAVKFLEKNASAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgcagagcgcgtaaagaagatcgtcgtggagcatctgggcgtggaagcc gacaaggtgaccgagaacgccagctttatcgacgacttgggcgctgacagtctggatacc gtcgaactggtcatggccttcgaggaagaattcggctgcgagatccctgatgatgccgca gagcacattctgacggtcggcgatgccgttaaattcctggaaaagaacgcaagcgcagcc tga

DBGET integrated database retrieval system