KEGG   Candidatus Filomicrobium marinum W: BN1229_v1_3651
Entry
BN1229_v1_3651    CDS       T03856                                 
Symbol
cheB
Name
(GenBank) Chemotaxis response regulator protein-glutamate methylesterase of group 2 operon
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
fil  Candidatus Filomicrobium marinum W
Pathway
fil02020  Two-component system
fil02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:fil00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN1229_v1_3651 (cheB)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BN1229_v1_3651 (cheB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:fil02022]
    BN1229_v1_3651 (cheB)
   02035 Bacterial motility proteins [BR:fil02035]
    BN1229_v1_3651 (cheB)
Enzymes [BR:fil01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BN1229_v1_3651 (cheB)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     BN1229_v1_3651 (cheB)
Two-component system [BR:fil02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   BN1229_v1_3651 (cheB)
Bacterial motility proteins [BR:fil02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BN1229_v1_3651 (cheB)
SSDB
Motif
Pfam: CheB_methylest Response_reg DXP_reductoisom
Other DBs
NCBI-ProteinID: CFX55902
UniProt: A0A0D6JKI9
LinkDB
Position
1:complement(3570850..3571878)
AA seq 342 aa
MPGQISVLVVDDSGVMRRALTRRIQTDSRFRVIDTASDGREGVEKTLKLRPDVVTLDVEM
PVMNGLEALRVIVSQTRTPVVMVSSVTKAGANITMEALEIGAVDFIAKSNSGDMIHEKLL
AAARAKLQRPAPIAPRTRVATPKLAATNRTHSLRTSPPKLCLIGSSTGGPQALQQVFGQL
PASLKVPIVVAQHMPAQFTDALAKRLNQICRPNVVEAKDGDFLSPGAIYIAPGGMQTRIV
ENQIRVSADKGESLYKPSIDVLGDSIFQAYGGRVLGVMLTGMGADGTKAFLKMHNAGAFN
IAQSEDTCAVYGMPRALVEANAADEQLDPEQIGARIANLIGK
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgcccgggcaaataagcgttctggtcgttgacgactcaggcgtcatgcggcgggctctg
acgagacgcatccagacggatagccgctttcgcgtgattgataccgcttccgatggccgt
gaaggcgtcgagaaaacgctgaagctgcgcccggatgtcgtcaccctcgacgtcgaaatg
cccgtaatgaacgggctagaggccttgcgggtaatcgtctcgcaaacgcgcactcccgtc
gtgatggtaagctcggtcacaaaagccggggctaacatcaccatggaagcgcttgagatc
ggcgcagtggattttatcgccaaatcgaacagtggcgacatgatccacgagaagctgctt
gcagccgcccgggccaaacttcagcgtcccgcaccaatcgcgccccgtacacgcgtcgca
acaccgaaactggcggcaacaaatcgaacgcatagcctgcgcacgtctccaccaaaatta
tgcctcattggaagttcaaccggcggcccacaggcactacagcaggtcttcggacaactc
ccagccagcctgaaggtaccaatcgttgtcgcgcagcatatgcccgcgcagttcaccgac
gctctggccaaacgcctgaaccagatttgcagacccaatgtcgttgaggcgaaggacgga
gatttcctgagccctggagcgatctatatcgcgccaggaggcatgcaaacacgcatcgtg
gaaaatcagatccgcgtgtcagcggataagggtgaaagcctctataagccaagcatcgac
gtgctcggcgatagtattttccaagcctatggcggccgcgttctgggcgtgatgcttacg
ggaatgggagcagacggcactaaggctttcttgaaaatgcacaacgccggcgcatttaac
atcgctcagagcgaagatacctgcgctgtctacggaatgccccgcgccctcgttgaagcc
aacgctgcggacgaacaacttgatcccgagcagatcggcgcgcgcattgccaacctaata
gggaaataa

DBGET integrated database retrieval system