Fructilactobacillus ixorae: M8332_00790 Help Entry M8332_00790       CDS       T08281                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fix  Fructilactobacillus ixorae Pathway fix01100   Metabolic pathways fix01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fix00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M8332_00790    00074 Mycolic acid biosynthesis     M8332_00790   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M8332_00790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1953 DUF1493 MCM4_WHD DUF7217 PqqD Motif Other DBs NCBI-ProteinID:  USS93437 LinkDB All DBs Position 181204..181461 Genome browser AA seq 85 aa AA seqDB search MSETSKEQILAKIKEIVADQTDDVKAEDITLETNFKEGLDLDSLDVFEIVDALEDEYDIE IDGDEGLETVQQLVDYVAKQVNDAN NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaactagtaaagaacaaattttagctaaaattaaggaaattgttgcggatcaa accgatgatgttaaggctgaggatatcaccttagaaactaactttaaggagggcctagat ctcgatagtctcgatgtctttgaaattgtggatgccctcgaagacgaatatgacattgaa attgatggcgacgaaggtcttgaaaccgtgcaacaactggttgattacgttgccaaacaa gttaacgacgctaattag

DBGET integrated database retrieval system