Flavobacterium johnsoniae UW101: Fjoh_3774 Help Entry Fjoh_3774         CDS       T00508                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism fjo  Flavobacterium johnsoniae UW101 Pathway fjo03430   Mismatch repair Brite KEGG Orthology (KO) [BR:fjo00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     Fjoh_3774  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:fjo03400]     Fjoh_3774 Enzymes [BR:fjo01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      Fjoh_3774 DNA repair and recombination proteins [BR:fjo03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      Fjoh_3774 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Thymosin Motif Other DBs NCBI-ProteinID:  ABQ06785 UniProt:  A5FDD1 LinkDB All DBs Position complement(4473392..4473538) Genome browser AA seq 48 aa AA seqDB search MEDETISVDELAAKVKRASELIEFCQAKLKSTETEVAKIISAMENAKE NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggaagatgaaacgatctctgtggatgagctggctgccaaagtcaaaagagcatctgaa ctcattgagttctgccaggcaaaacttaaatctaccgagactgaagtagctaaaattatc agcgcgatggagaacgcgaaggagtga

DBGET integrated database retrieval system