Fusarium keratoplasticum: NCS57_00438300 Help Entry NCS57_00438300    CDS       T09757                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism fkr  Fusarium keratoplasticum Pathway fkr03060   Protein export fkr04141   Protein processing in endoplasmic reticulum fkr04145   Phagosome Brite KEGG Orthology (KO) [BR:fkr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     NCS57_00438300    04141 Protein processing in endoplasmic reticulum     NCS57_00438300  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     NCS57_00438300  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fkr04131]     NCS57_00438300   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:fkr02044]     NCS57_00438300 Membrane trafficking [BR:fkr04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     NCS57_00438300 Secretion system [BR:fkr02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    NCS57_00438300 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  77682649 NCBI-ProteinID:  XP_052916504 LinkDB All DBs Position 3:<3399383..>3399697 Genome browser AA seq 70 aa AA seqDB search MSDQVQELLEVPSEFVKDGVQFMRRCTKPDQQEFLRLCQAVGVGFLIMGAVGYVVKLVHI PLNHALVGSA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccgaccaggttcaagagcttctcgaggttccctccgagttcgtcaaggacggcgtt cagttcatgcgacgatgcactaagcccgaccagcaggagttcctgcgactctgccaggcc gttggcgttggcttcctcatcatgggcgctgtcggctacgttgtcaagctggtgcatatc cccctcaaccacgctctcgtgggcagcgcataa

DBGET integrated database retrieval system