Ferrigenium kumadai: FGKAn22_02690 Help Entry FGKAn22_02690     CDS       T07187                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism fku  Ferrigenium kumadai Pathway fku01100   Metabolic pathways fku01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fku00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FGKAn22_02690    00074 Mycolic acid biosynthesis     FGKAn22_02690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FGKAn22_02690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF3979 PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  BBI98576 UniProt:  A0AAN1SXV3 LinkDB All DBs Position complement(306077..306295) Genome browser AA seq 72 aa AA seqDB search MVKQFDLQIENLTPDATLESLGLDSLSVIEFMFNLEDELKIKLPDERVEIKTLQDVVNLV DKLLAEQKGPAQ NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggtcaagcagttcgacctgcagatcgaaaacctcacaccggacgccacgctggaaagc ctgggactggactccctgtcggtgatcgagttcatgttcaatcttgaggacgaactcaag atcaagttgccggatgagcgcgtcgagatcaaaacactgcaggacgtagtcaatctggtg gacaagttgcttgccgaacaaaaaggccccgctcagtaa

DBGET integrated database retrieval system