Flagellimonas sp. MMG031: ABNE31_10330 Help Entry ABNE31_10330      CDS       T10636                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fld  Flagellimonas sp. MMG031 Brite KEGG Orthology (KO) [BR:fld00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fld03032]     ABNE31_10330    03036 Chromosome and associated proteins [BR:fld03036]     ABNE31_10330    03400 DNA repair and recombination proteins [BR:fld03400]     ABNE31_10330 DNA replication proteins [BR:fld03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ABNE31_10330 Chromosome and associated proteins [BR:fld03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ABNE31_10330 DNA repair and recombination proteins [BR:fld03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ABNE31_10330 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg VWA_2 Motif Other DBs NCBI-ProteinID:  XBQ21994 UniProt:  A0AAU7MUC7 LinkDB All DBs Position complement(2298843..2299115) Genome browser AA seq 90 aa AA seqDB search MNKTELIDAMAADAGITKAAAKKALESFLGNVEGTLKKGDRVSLVGFGSWSVSKRSAREG RNPQTGATIKIAAKNVVKFKAGAELSSAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattaatcgatgctatggcagctgatgctggcatcactaaggcagca gcaaaaaaagcattggaatctttcttgggaaatgtagaaggaacgcttaaaaaaggagac agagtttccttggtaggttttggttcttggtcagtttctaaaagaagcgctagagaaggt agaaatccacagactggagctactattaagattgccgctaagaacgttgtaaagttcaaa gcaggtgctgaattgagcagtgcagtaaactaa

DBGET integrated database retrieval system