Ferribacterium limneticum: KI610_10000 Help Entry KI610_10000       CDS       T07599                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fle  Ferribacterium limneticum Pathway fle01100   Metabolic pathways fle01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fle00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KI610_10000   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KI610_10000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CorC_HlyC Motif Other DBs NCBI-ProteinID:  UCV17191 LinkDB All DBs Position complement(2092405..2092671) Genome browser AA seq 88 aa AA seqDB search MSQQQEQIRTAVLAIVKRLAPEVDPTKIIPDKPLRSQIDLDSMDWLNVLAAIHEKLGVDI PETDYGKVQTLDSIVAYLAGKIPADSLE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagtcagcaacaagaacaaatccgcacggccgtgctcgccatcgtcaagcgcctggcc ccggaagtcgatccgacgaagatcatccccgacaagcccctgcgcagccagatcgatctg gattcgatggactggctcaacgtgctggccgccatccacgaaaagctcggcgtagacatt cccgaaaccgactacggcaaggtccagacgctggatagcatcgtcgcctacctcgccgga aaaatccctgccgactcgctggagtaa

DBGET integrated database retrieval system