Ferribacterium limneticum: KI610_15400 Help Entry KI610_15400       CDS       T07599                                  Name (GenBank) MmoB/DmpM family protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism fle  Ferribacterium limneticum Pathway fle00361   Chlorocyclohexane and chlorobenzene degradation fle00362   Benzoate degradation fle00623   Toluene degradation fle01100   Metabolic pathways fle01120   Microbial metabolism in diverse environments fle01220   Degradation of aromatic compounds Module fle_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:fle00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     KI610_15400    00361 Chlorocyclohexane and chlorobenzene degradation     KI610_15400    00623 Toluene degradation     KI610_15400 Enzymes [BR:fle01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      KI610_15400     1.14.13.244  phenol 2-monooxygenase (NADH)      KI610_15400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  UCV18183 LinkDB All DBs Position complement(3252313..3252582) Genome browser AA seq 89 aa AA seqDB search MSTVFIALQANEDTRPIIDAIVQDNPTAIVNRQPAMVKIDVPGSMTIRRETIEEHIGRAY DLQELQINLITLSGNVDEDEDSFTLRWNA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccgtattcattgccctgcaagccaacgaagacacgcgtccgatcatcgacgcc atcgtgcaagacaacccgactgccatcgtcaatcgccagccggccatggtcaagatcgac gttcccggttcgatgaccatccgtcgcgaaaccatcgaggaacacataggccgcgcctac gacctgcaggaactgcagatcaacctgatcaccctctccggcaatgtcgacgaggacgaa gacagcttcaccctgcgctggaatgcctga

DBGET integrated database retrieval system