Ferribacterium limneticum: KI610_19720 Help Entry KI610_19720       CDS       T07599                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fle  Ferribacterium limneticum Pathway fle01100   Metabolic pathways fle01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fle00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KI610_19720    00074 Mycolic acid biosynthesis     KI610_19720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KI610_19720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UCV18979 LinkDB All DBs Position 4116746..4116985 Genome browser AA seq 79 aa AA seqDB search MESIGLIRDFLKDRLGVEPENVVPGAVLAELGVDSLMMLELMFEFEDRFGIKLSRDIKTP RTVGEMVALMDGLIAQSKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaatccattggcctgattcgcgattttctcaaggaccgcctcggcgtcgagccggaa aatgtcgttcccggcgccgtgctggctgagcttggcgtggactcgctgatgatgctcgaa ctgatgttcgagttcgaggatcgcttcggcatcaagctgtctcgcgacatcaaaactccc cggaccgttggcgagatggttgcgctgatggacgggctgatcgcccagtcgaagagctga

DBGET integrated database retrieval system