Flaviflexus ciconiae: EJ997_02465 Help Entry EJ997_02465       CDS       T05772                                  Name (GenBank) hypothetical protein   KO K02342   DNA polymerase III subunit epsilon [EC:2.7.7.7] Organism flh  Flaviflexus ciconiae Pathway flh03030   DNA replication flh03430   Mismatch repair flh03440   Homologous recombination Brite KEGG Orthology (KO) [BR:flh00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     EJ997_02465    03430 Mismatch repair     EJ997_02465    03440 Homologous recombination     EJ997_02465  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:flh03032]     EJ997_02465    03400 DNA repair and recombination proteins [BR:flh03400]     EJ997_02465 Enzymes [BR:flh01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      EJ997_02465 DNA replication proteins [BR:flh03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      EJ997_02465 DNA repair and recombination proteins [BR:flh03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      EJ997_02465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNase_T Motif Other DBs NCBI-ProteinID:  AZQ76372 UniProt:  A0A3S9PVN8 LinkDB All DBs Position complement(530358..530729) Genome browser AA seq 123 aa AA seqDB search MGFLNAEFARARYPVTIPRAAGVCTMDQSRIYLPPGRHNLAACLERAEITLPVKHRSIAD AQCSAALLAHYLETELSGVRYADTAQDRHGNLVLPREWERAAEAARSIQWLDIADLGPAT LNS NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atcgggttcctcaacgccgagtttgctcgcgcacgatatcccgtgacgattccccgggca gcgggggtatgcacgatggatcagtcgcgaatctatctcccgccgggccggcataacctt gccgcctgtctggaacgtgcggaaattacgctgcccgtgaagcatcggagcattgccgat gcccagtgttccgctgctcttcttgcccattatctagaaaccgagctgagcggcgtacgg tacgcagacaccgcccaagaccggcacggcaaccttgttctaccccgggaatgggaacgc gccgcagaagcggcgcgttccatccagtggctcgacattgccgaccttgggccggcaacc cttaattcctag

DBGET integrated database retrieval system