Fomitiporia mediterranea: FOMMEDRAFT_113874 Help Entry FOMMEDRAFT_113874 CDS       T03132                                  Name (RefSeq) secE/sec61-gamma protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism fme  Fomitiporia mediterranea Pathway fme03060   Protein export fme04141   Protein processing in endoplasmic reticulum fme04145   Phagosome Brite KEGG Orthology (KO) [BR:fme00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     FOMMEDRAFT_113874    04141 Protein processing in endoplasmic reticulum     FOMMEDRAFT_113874  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     FOMMEDRAFT_113874  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fme04131]     FOMMEDRAFT_113874   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:fme02044]     FOMMEDRAFT_113874 Membrane trafficking [BR:fme04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     FOMMEDRAFT_113874 Secretion system [BR:fme02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    FOMMEDRAFT_113874 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  18670759 NCBI-ProteinID:  XP_007271107 JGI:  Fomme1_113874 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MSEKLKEFAEVPQQFLREGNQFMTRCTKPTKKEFIQICRAVAVGFAVMGFIGYFVKLIHI PINNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaaaactcaaggagttcgctgaggtgcctcagcagttcttgcgtgaggggaac cagtttatgacacggtgtaccaaacctacaaagaaggagtttatacagatctgcagggca gtcgccgttggtttcgccgttatgggtttcattgggtacttcgtcaagttaattcacatt ccaataaacaatatacttgtcggaggtgcatga

DBGET integrated database retrieval system