Fomitiporia mediterranea: FOMMEDRAFT_154618 Help Entry FOMMEDRAFT_154618 CDS       T03132                                  Name (RefSeq) hypothetical protein   KO K10991   DNA repair protein Swi5/Sae3 Organism fme  Fomitiporia mediterranea Brite KEGG Orthology (KO) [BR:fme00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:fme03400]     FOMMEDRAFT_154618 DNA repair and recombination proteins [BR:fme03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      FOMMEDRAFT_154618 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Swi5 ArgJ DUF6156 Motif Other DBs NCBI-GeneID:  18674380 NCBI-ProteinID:  XP_007265143 JGI:  Fomme1_154618 LinkDB All DBs Position Unknown AA seq 84 aa AA seqDB search MIASQSNTKASSNREEALRAEIASLHALLGETEGADKIVTKHIKLLHDYNEAKDAAQIII GKLAMRKETTIKQLHEQYGLSKDD NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgatcgcaagtcagagtaacacgaaggctagctccaatcgggaagaagcattacgagct gaaatcgctagcttgcatgcactacttggagaaacagaaggtgcagataagatagtcaca aagcatatcaagctgttacatgactacaacgaagcgaaggatgcggctcagatcatcata gggaagcttgccatgcgtaaggagacgacgattaagcaattgcatgagcaatacggactt tctaaggatgattaa

DBGET integrated database retrieval system