Fidelibacter multiformis: FMIA91_02010 Help Entry FMIA91_02010      CDS       T10786                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fml  Fidelibacter multiformis Pathway fml01100   Metabolic pathways fml01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fml00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FMIA91_02010    00074 Mycolic acid biosynthesis     FMIA91_02010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FMIA91_02010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Toxin_10 Motif Other DBs NCBI-ProteinID:  BFN36322 LinkDB All DBs Position 248135..248380 Genome browser AA seq 81 aa AA seqDB search MEEKVIFEKVLEILKPYVREAEDLKTATEETDILNDLKVNSSRLVDIILAIEDEFDIEVS DDEADEVQTIGDTVSLITGKI NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaagaaaaagtcatctttgagaaagtccttgagattctcaaaccctatgtgcgtgaa gcagaagacttgaaaactgcaacggaagagacagatattttaaatgatctgaaagtaaat tcttcccggctggtagacattattctggccattgaggatgaatttgatattgaagtctcg gatgatgaggccgatgaggttcagacaattggtgatactgtttctttgatcaccgggaaa atttaa

DBGET integrated database retrieval system