Fuerstiella marisgermanici: Fuma_05787 Help Entry Fuma_05787        CDS       T04678                                  Symbol acpP_3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism fmr  Fuerstiella marisgermanici Pathway fmr00998   Biosynthesis of various antibiotics fmr01100   Metabolic pathways fmr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fmr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Fuma_05787 (acpP_3)    00074 Mycolic acid biosynthesis     Fuma_05787 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Fuma_05787 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 MutS_IV Motif Other DBs NCBI-ProteinID:  APZ96119 UniProt:  A0A1P8WPY9 LinkDB All DBs Position 7710915..7711178 Genome browser AA seq 87 aa AA seqDB search MTGEEIRQVVLEILERIAPDEDLSDLDDSVAFREQMELDSMDFLDIVMELRKAYRVQIPE EDYQNLNTMSSTVEYLTPKLKDVPVTT NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacgggtgaggagatcaggcaggtcgttctggaaattctggagcgaatcgctccggac gaagatctgtccgatctggacgattctgtcgccttccgcgaacagatggagctggacagc atggacttcctggacattgtgatggagctgcgcaaagcgtatcgcgtgcagattccggaa gaggattaccaaaacctcaacacgatgtcttcgacggtcgagtatctaacgccaaaactc aaagacgtgccggtcacgacgtag

DBGET integrated database retrieval system