Fusarium musae: J7337_001071 Help Entry J7337_001071      CDS       T09538                                  Name (RefSeq) hypothetical protein   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism fmu  Fusarium musae Pathway fmu03018   RNA degradation fmu03040   Spliceosome Brite KEGG Orthology (KO) [BR:fmu00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     J7337_001071   09123 Folding, sorting and degradation    03018 RNA degradation     J7337_001071  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:fmu03019]     J7337_001071    03041 Spliceosome [BR:fmu03041]     J7337_001071 Messenger RNA biogenesis [BR:fmu03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      J7337_001071   mRNA degradation factors    5'-3' decay     Lsm complex      J7337_001071 Spliceosome [BR:fmu03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     J7337_001071 SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  68308928 NCBI-ProteinID:  XP_044686517 UniProt:  A0A9P8IW37 LinkDB All DBs Position 1:<3553653..>3554072 Genome browser AA seq 67 aa AA seqDB search MATLGGYLNKRIIRTPDDPEPSAQVPLGLYLVRGDNVCSIGLVDEALDDSINWTEVKGSA IGGIKHV NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctacactcggtggatatctcaacaaacgaattatccgaacgcccgacgatcctgag ccttccgctcaagtgcctttaggtctatacctcgtccgtggcgacaatgtatgctcaatc ggcctcgtagatgaggcgcttgacgacagcatcaactggacggaagtcaagggttcagca atcggcggtataaagcacgtatag

DBGET integrated database retrieval system