Fusarium musae: J7337_008788 Help Entry J7337_008788      CDS       T09538                                  Symbol RAC1 Name (RefSeq) Rho GTPase protein rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism fmu  Fusarium musae Pathway fmu04145   Phagosome fmu04148   Efferocytosis fmu04620   Toll-like receptor signaling pathway fmu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:fmu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     J7337_008788 (RAC1)    04148 Efferocytosis     J7337_008788 (RAC1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     J7337_008788 (RAC1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     J7337_008788 (RAC1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fmu04131]     J7337_008788 (RAC1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fmu04147]     J7337_008788 (RAC1)    04031 GTP-binding proteins [BR:fmu04031]     J7337_008788 (RAC1) Membrane trafficking [BR:fmu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     J7337_008788 (RAC1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     J7337_008788 (RAC1)   Macropinocytosis    Ras GTPases     J7337_008788 (RAC1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     J7337_008788 (RAC1) Exosome [BR:fmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    J7337_008788 (RAC1)   Exosomal proteins of other body fluids (saliva and urine)    J7337_008788 (RAC1)   Exosomal proteins of colorectal cancer cells    J7337_008788 (RAC1)   Exosomal proteins of bladder cancer cells    J7337_008788 (RAC1) GTP-binding proteins [BR:fmu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     J7337_008788 (RAC1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  68316644 NCBI-ProteinID:  XP_044679313 UniProt:  A0A9P8DE95 LinkDB All DBs Position 6:complement(3017369..3018206) Genome browser AA seq 199 aa AA seqDB search MAQPGVQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVMVDGKPISLGL WDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKAKWYPEIDHHAPNIPIILVGT KLDLREDASTLESLRQKRMEPVSYEQALTCAKEIKAYKYLECSALTQRNLKSVFDEAIRA VLNPRPTPSKQKKNKCSIL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atggctcagcccggtgtccagtcattgaagtgcgtggtgactggtgatggtgctgttgga aagacctgtctactcatttcctacaccacaaatgccttccccggcgaatacatccccact gtcttcgacaactactcggcgagtgttatggtagatggcaagcctattagccttggcctc tgggatactgctggtcaggaggattacgacagactgcgacctctctcatacccccagacc gatgtcttcctcatctgcttctccatcgtcagccctccttcattcgacaacgtgaaggcc aagtggtatcccgagattgatcatcatgcgcctaacattcccatcatccttgtcggaacc aagcttgatcttcgtgaagacgcctccaccctcgaatcacttcgacagaagcgtatggag cctgtgtcgtacgagcaggcgttgacctgcgccaaggagatcaaggcctacaagtacctc gagtgttctgccctcactcaaaggaacctcaagagcgtttttgacgaggccatccgagct gttcttaaccctcgacccacaccttcgaagcaaaagaagaacaagtgctccattctgtag

DBGET integrated database retrieval system