Fusarium musae: J7337_008810 Help Entry J7337_008810      CDS       T09538                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism fmu  Fusarium musae Pathway fmu03060   Protein export fmu04141   Protein processing in endoplasmic reticulum fmu04145   Phagosome Brite KEGG Orthology (KO) [BR:fmu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     J7337_008810    04141 Protein processing in endoplasmic reticulum     J7337_008810  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     J7337_008810  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fmu04131]     J7337_008810   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:fmu02044]     J7337_008810 Membrane trafficking [BR:fmu04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     J7337_008810 Secretion system [BR:fmu02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    J7337_008810 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  68316666 NCBI-ProteinID:  XP_044679334 UniProt:  A0A9P8DE87 LinkDB All DBs Position 6:<3060220..>3060540 Genome browser AA seq 70 aa AA seqDB search MSDQVQEILEVPSEFVKDGVQFVRRCTKPDQKEFLRLCQAVGVGFLIMGAVGYVVKLVHI PLNHALVGSA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccgaccaggttcaagagatcctcgaggttccctccgagttcgtcaaggacggagtt caattcgtgcgacgatgcaccaagcctgaccagaaggagttcctacgcctctgccaggct gttggcgttggtttcctcatcatgggcgctgttggctacgttgtcaagctggtgcacatt cccctcaaccacgctctcgtcggtagcgcataa

DBGET integrated database retrieval system