Fusarium musae: J7337_011475 Help Entry J7337_011475      CDS       T09538                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism fmu  Fusarium musae Pathway fmu03020   RNA polymerase fmu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fmu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     J7337_011475   09124 Replication and repair    03420 Nucleotide excision repair     J7337_011475  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fmu03021]     J7337_011475    03400 DNA repair and recombination proteins [BR:fmu03400]     J7337_011475 Transcription machinery [BR:fmu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      J7337_011475   RNA polymerase III system    RNA polymerase III      J7337_011475   RNA polymerase I system    RNA polymerase I      J7337_011475 DNA repair and recombination proteins [BR:fmu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       J7337_011475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_RNApol_7kD Zn_Tnp_IS1595 Zn-ribbon_8 HypA zinc_ribbon_9 YjdM_Zn_Ribbon DnaJ_CXXCXGXG zf-C2HC5 YacG Anti-TRAP Motif Other DBs NCBI-GeneID:  68319331 NCBI-ProteinID:  XP_044675694 LinkDB All DBs Position 9:649341..649629 Genome browser AA seq 72 aa AA seqDB search MPREEYQVPTANAGQRGGTRDDHQVRHVMSYICGDCGGSVTLGKDATVACPHCAGRVLYK ERTKRMVQFEAR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgccccgcgaagaataccaagtccccaccgccaacgccggccagcgcggcggcacccgc gacgaccaccaagtccgtcacgtcatgtcttatatctgcggcgactgcggcggcagcgtc accctcggaaaggatgccaccgtcgcgtgccctcactgcgcaggccgtgttctctacaag gaacgcacgaagcgaatggttcagttcgaggcccgatag

DBGET integrated database retrieval system