Fervidobacterium ngatamarikiense: JM64_02505 Help Entry JM64_02505        CDS       T10794                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fng  Fervidobacterium ngatamarikiense Pathway fng01100   Metabolic pathways fng01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fng00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JM64_02505    00074 Mycolic acid biosynthesis     JM64_02505   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JM64_02505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Ribosomal_L50 Ribosomal_L12_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  ANE40995 UniProt:  A0A172T1W5 LinkDB All DBs Position complement(528486..528716) Genome browser AA seq 76 aa AA seqDB search MDLEKRVCEIVAEQLGLDISEVTPDKNLMEDLGADSLDVVDLVMAFEDEFGVKISDQDLS KIKTVKDVVEAIRLRS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggatttggaaaagagagtgtgcgaaatcgtagcagaacaacttgggttggatatctcg gaagttacaccagataagaacttaatggaagacctgggtgctgattctctcgatgtcgta gatttagttatggcttttgaagatgagtttggtgtgaagataagcgatcaagatttgtcg aaaataaaaacggtgaaggatgttgtggaagcaataagacttcgttcataa

DBGET integrated database retrieval system