Flavobacterium nackdongense: E1750_14860 Help Entry E1750_14860       CDS       T06713                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fnk  Flavobacterium nackdongense Brite KEGG Orthology (KO) [BR:fnk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fnk03032]     E1750_14860    03036 Chromosome and associated proteins [BR:fnk03036]     E1750_14860    03400 DNA repair and recombination proteins [BR:fnk03400]     E1750_14860 DNA replication proteins [BR:fnk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E1750_14860 Chromosome and associated proteins [BR:fnk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E1750_14860 DNA repair and recombination proteins [BR:fnk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E1750_14860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  QBN20022 UniProt:  A0A4V1AH21 LinkDB All DBs Position complement(3455574..3455846) Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAADAGITKAAAKLALESFLGNVGSTLKKGGRVSLVGFGSWSVSSRAARDG RNPQTGKTIKIAAKNVVKFKAGAELEGAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatcagaattaatcgacgctatcgctgctgatgcaggaattacaaaagctgct gctaaactagctttagaatcttttttaggaaacgtaggtagtactttgaaaaaaggtgga agagtatctttagtaggtttcggatcttggtcagtttcttcaagagctgcaagagatggt agaaatcctcaaacaggaaaaacaataaaaattgctgctaaaaatgtagtgaaatttaaa gctggagctgaattagaaggcgctgtaaactaa

DBGET integrated database retrieval system