Francisella orientalis LADL 07-285A: M973_04380 Help Entry M973_04380        CDS       T02952                                  Name (GenBank) acetolactate synthase   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism fnl  Francisella orientalis LADL 07-285A Pathway fnl00290   Valine, leucine and isoleucine biosynthesis fnl00650   Butanoate metabolism fnl00660   C5-Branched dibasic acid metabolism fnl00770   Pantothenate and CoA biosynthesis fnl01100   Metabolic pathways fnl01110   Biosynthesis of secondary metabolites fnl01210   2-Oxocarboxylic acid metabolism fnl01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:fnl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     M973_04380    00660 C5-Branched dibasic acid metabolism     M973_04380   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     M973_04380   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     M973_04380 Enzymes [BR:fnl01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      M973_04380 SSDB OrthologParalogGFIT Motif Pfam:  ACT_AHAS_ss ACT_5 ACT ACT_4 MCPsignal Exotox-A_bind Motif Other DBs NCBI-ProteinID:  AHB98299 LinkDB All DBs Position 797321..797638 Genome browser AA seq 105 aa AA seqDB search MSENIYFITMNTENTLCVLQRISSVLSRNRVNIEQLTVFETANKGISHFNLVVHSTQDKI EKIVKKLANVIEVIDINITNCLPMQGTVISEIPQNVKTVSQRKVA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaaatatatattttataacaatgaatacggaaaatactctttgtgtgttacaa agaatttcttctgttttatcacgtaatcgtgtaaatatagaacagttaacagtatttgag acagcaaataaaggtatttctcatttcaatcttgtagtacatagtacgcaagataagata gaaaaaatcgtaaaaaaactggcaaatgtgattgaagtaatagatattaatattacaaac tgtttacctatgcaaggaactgtaataagtgaaattcctcaaaacgtaaaaacagttagt caaagaaaagtagcttaa

DBGET integrated database retrieval system