Fervidobacterium nodosum: Fnod_1573 Help Entry Fnod_1573         CDS       T00579                                  Name (GenBank) Fe-S cluster domain protein   KO K03616   H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] Organism fno  Fervidobacterium nodosum Brite KEGG Orthology (KO) [BR:fno00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Fnod_1573 Enzymes [BR:fno01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.11  ferredoxin---NAD+ oxidoreductase (H+-transporting)      Fnod_1573   7.2  Catalysing the translocation of inorganic cations    7.2.1  Linked to oxidoreductase reactions     7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)      Fnod_1573 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FeS DUF2953 Motif Other DBs NCBI-ProteinID:  ABS61416 UniProt:  A7HND3 LinkDB All DBs Position complement(1714745..1715023) Genome browser AA seq 92 aa AA seqDB search MVVVYSAILLGGIGFAFGLFLSYVSEKFKVEEDPTVKLILEALPGINCGACGYPGCEGYA KAIAKGDKPDKCLPGKKNGVEEKIKEILANKK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtggtggtcgtttattcagctattttacttggtggtataggctttgcatttggtcttttc ttatcttatgttagtgaaaagttcaaagtagaggaggatcctactgttaaactaatctta gaagcattaccaggtataaattgtggcgcatgtggatatcctggctgtgaaggttacgca aaggctatcgcaaaaggagataagcctgacaaatgtttgcctggtaagaaaaatggcgta gaagaaaaaatcaaagaaatactggcaaacaaaaagtaa

DBGET integrated database retrieval system