Francisella opportunistica: CGC45_02265 Help Entry CGC45_02265       CDS       T06355                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism foo  Francisella opportunistica Pathway foo01100   Metabolic pathways foo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:foo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CGC45_02265    00074 Mycolic acid biosynthesis     CGC45_02265   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CGC45_02265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AXH32786 LinkDB All DBs Position complement(465591..465833) Genome browser AA seq 80 aa AA seqDB search MSANEVYAKVNSIIVEQLGVKEEDLKPEASFIDDLGADSLDTVELVMALEEEFDTEIPDE DGEKIRTVKDVYDYIDSKVN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgcaaatgaagtatatgctaaagtaaactctatcatagttgagcaactaggtgtt aaagaagaagatctaaaaccagaagcttctttcattgatgatttaggtgctgactctcta gatacagttgaacttgtaatggctctagaagaagaatttgatactgagattccagatgaa gatggtgagaaaatcagaactgttaaagatgtttacgactatatcgactctaaagtaaac taa

DBGET integrated database retrieval system