Fusarium oxysporum: FOXG_00852 Help Entry FOXG_00852        CDS       T04882                                  Name (RefSeq) dynein light chain LC8-type   KO K10418   dynein light chain LC8-type Organism fox  Fusarium oxysporum Pathway fox04814   Motor proteins Brite KEGG Orthology (KO) [BR:fox00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     FOXG_00852  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fox03037]     FOXG_00852    04812 Cytoskeleton proteins [BR:fox04812]     FOXG_00852 Cilium and associated proteins [BR:fox03037]  Motile cilia and associated proteins   Dynein arm    FOXG_00852 Cytoskeleton proteins [BR:fox04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      FOXG_00852 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light SGTA_dimer Motif Other DBs NCBI-GeneID:  28943142 NCBI-ProteinID:  XP_018233189 UniProt:  A0A0J9U7I6 LinkDB All DBs Position 1:4302278..4305982 Genome browser AA seq 103 aa AA seqDB search MADAHVPKAESPVAREKLEAQIKSADMTEDMQQESIEVAQEAMAKFTIEKDIAQHIKRTF DERKGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggccgacgctcacgttcccaaggcagagtctcccgtcgctcgggagaagctcgaggct cagatcaagtccgccgacatgacggaggatatgcaacaggagtctatcgaagttgcccag gaagccatggccaagttcaccattgagaaggacatcgcacagcacatcaagcgcacattc gacgagcgaaagggaccaacctggcactgcattgttggccgaaatttcggtagcttcgtt acccacgagaccaagcactttatctacttttacctcggccactgcgcaattctactattc aaaacgcaatag

DBGET integrated database retrieval system