Fusarium oxysporum: FOXG_01639 Help Entry FOXG_01639        CDS       T04882                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism fox  Fusarium oxysporum Pathway fox03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:fox00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     FOXG_01639  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fox03036]     FOXG_01639    03400 DNA repair and recombination proteins [BR:fox03400]     FOXG_01639 Chromosome and associated proteins [BR:fox03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      FOXG_01639 DNA repair and recombination proteins [BR:fox03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      FOXG_01639 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID-18kDa TFIID-31kDa Histone BrxL_ATPase TAF Motif Other DBs NCBI-GeneID:  28943882 NCBI-ProteinID:  XP_018234497 UniProt:  A0A0J9UC80 LinkDB All DBs Position 5:complement(1613879..1616718) Genome browser AA seq 113 aa AA seqDB search MADTTSDEDRERLKAALWYAVGQIVDEESLRRNRNATPQFIGALTELVWTQVENVATDLE SFSNHAGRSTVTTDDVLLLARKNPDLHQIMKEFVDQAKAEKGTAKSRGGASKR NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcagacacaaccagtgacgaagatcgagagcgcctgaaggctgccttgtggtacgca gttggccaaatagttgatgaggagtctttacgtcgtaaccgaaatgccacaccacagttc atcggcgcactcacagagctagtctggacacaagtcgaaaacgttgccacagatctggag agtttcagcaaccacgctggacggtccacagtgacaacagacgatgtgttactcctcgcc aggaagaatcccgatctacatcagatcatgaaagagtttgttgaccaggccaaggcagag aagggaactgcaaagagtagaggcggtgcgagcaaacgttag

DBGET integrated database retrieval system