Fusarium oxysporum: FOXG_17503 Help Entry FOXG_17503        CDS       T04882                                  Name (RefSeq) Cu/Zn superoxide dismutase   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism fox  Fusarium oxysporum Pathway fox04146   Peroxisome Brite KEGG Orthology (KO) [BR:fox00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     FOXG_17503 Enzymes [BR:fox01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      FOXG_17503 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  28958258 NCBI-ProteinID:  XP_018258487 UniProt:  A0A0J9WW05 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MVKASVSTVFGTITFEQFDESSPINISWNIRGNHANSLRAFHIHEFGDKTNGCTSAGPHC LESVIRGILAKGLLIKRL NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggtcaaggcaagtgtttccaccgtctttggcaccattaccttcgagcagttcgacgaa agctcaccaataaacatctcctggaatatccgtggcaaccatgccaatagtctaagagca ttccatatccacgagtttggtgacaagaccaacggatgcacctctgctggaccgcattgc ctagagagcgttatcagaggaatattagcgaaaggcctgcttataaaacggttatag

DBGET integrated database retrieval system