Fusobacterium pseudoperiodonticum: CTM68_09255 Help Entry CTM68_09255       CDS       T05232                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fpd  Fusobacterium pseudoperiodonticum Pathway fpd01100   Metabolic pathways fpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CTM68_09255    00074 Mycolic acid biosynthesis     CTM68_09255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CTM68_09255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7080 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ATV57843 UniProt:  A0AAD0HTA5 LinkDB All DBs Position complement(1851052..1851279) Genome browser AA seq 75 aa AA seqDB search MLDKVREIIVEQLGVEPDQVKPESNFVDDLGADSLDTVELIMSFEEEFGVEIPDTEAEKI KTVQDVINYIEANKK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgttagataaagtaagagaaattatagttgaacaattaggagttgaacctgatcaagtt aaacctgaatcaaacttcgtagatgatttaggagcagattctttagatactgttgaatta ataatgtcttttgaagaagaatttggagtagaaattcctgatactgaagctgaaaaaatt aaaactgttcaagatgttataaactacatagaagcaaataagaaataa

DBGET integrated database retrieval system