Fervidobacterium pennivorans: Ferpe_0893 Help Entry Ferpe_0893        CDS       T01808                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fpe  Fervidobacterium pennivorans Pathway fpe01100   Metabolic pathways fpe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fpe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ferpe_0893    00074 Mycolic acid biosynthesis     Ferpe_0893   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ferpe_0893 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Ribosomal_L50 Ribosomal_L12_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  AFG35005 UniProt:  H9UBW2 LinkDB All DBs Position 953137..953367 Genome browser AA seq 76 aa AA seqDB search MDLEKRVCEIVAEQLGLDISEVTPDKNLMEDLGADSLDVVDLVMAFEDEFGVKISDQDLS KIKTVKDVVEAIRLRS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggatttggaaaaaagagtgtgtgaaatcgtagcagaacaacttgggttggatatctcg gaagttacaccagacaagaacttgatggaagacctcggtgctgattctcttgatgttgta gatttagttatggcttttgaagatgagtttggtgtgaagataagcgatcaagacttgtcg aagataaaaacggtaaaggatgttgtggaagcaataagacttcgctcataa

DBGET integrated database retrieval system