Fervidobacterium pennivorans: Ferpe_1519 Help Entry Ferpe_1519        CDS       T01808                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fpe  Fervidobacterium pennivorans Pathway fpe01100   Metabolic pathways fpe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fpe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ferpe_1519    00074 Mycolic acid biosynthesis     Ferpe_1519   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ferpe_1519 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AFG35587 UniProt:  H9UDJ4 LinkDB All DBs Position complement(1556417..1556668) Genome browser AA seq 83 aa AA seqDB search MEREELFKKVAEIISEKLNVPIEDIEEDSHLIEDLGADSLDAFDLVMVFEDEFGIKLEDD EIEKLMTVKDIVSLLQEKLKDRE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggaaagagaagaactcttcaaaaaagttgcagagattatttctgagaagttgaacgtt cctatcgaggatattgaggaagatagccacttaattgaagaccttggcgcagattctcta gatgcgtttgatttggttatggtcttcgaagatgagttcggtataaaactcgaggacgat gaaattgagaagttgatgactgtaaaagatatagttagcttgctccaggagaaactgaaa gatagggaataa

DBGET integrated database retrieval system