Fontisphaera persica: NXS98_06755 Help Entry NXS98_06755       CDS       T09048                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fpes  Fontisphaera persica Brite KEGG Orthology (KO) [BR:fpes00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fpes03032]     NXS98_06755    03036 Chromosome and associated proteins [BR:fpes03036]     NXS98_06755    03400 DNA repair and recombination proteins [BR:fpes03400]     NXS98_06755 DNA replication proteins [BR:fpes03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NXS98_06755 Chromosome and associated proteins [BR:fpes03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     NXS98_06755 DNA repair and recombination proteins [BR:fpes03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       NXS98_06755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding SasG_E HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  WCJ60823 LinkDB All DBs Position 1920326..1920613 Genome browser AA seq 95 aa AA seqDB search MAKALTKSALAAALAEKAGITKKQANIVLVELAQLAYKNAKNTFTLPGIGKLVLVNRKAR QGRNPATGEVIQIPAKKVVKFRVAKACKDAVLGKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaaagcacttaccaagtcggcgttggcggcggcactcgctgaaaaggcgggcatc accaaaaagcaagcgaacatcgttttggtggagctggctcaactggcgtacaaaaacgcc aagaacaccttcaccctgccgggcattggcaagttggtgctggtcaatcgcaaggcgcgg cagggccgcaatccggccaccggtgaggtcatccagattccggccaagaaagtggtgaag ttccgcgtggccaaggcgtgcaaggacgcggtgctgggcaagaaatag

DBGET integrated database retrieval system