Falco peregrinus (peregrine falcon): 101911124 Help Entry 101911124         CDS       T02856                                  Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism fpg  Falco peregrinus (peregrine falcon) Pathway fpg04060   Cytokine-cytokine receptor interaction fpg04218   Cellular senescence fpg04620   Toll-like receptor signaling pathway fpg04621   NOD-like receptor signaling pathway fpg04622   RIG-I-like receptor signaling pathway fpg05132   Salmonella infection fpg05164   Influenza A Brite KEGG Orthology (KO) [BR:fpg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101911124  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     101911124  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101911124    04621 NOD-like receptor signaling pathway     101911124    04622 RIG-I-like receptor signaling pathway     101911124  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     101911124   09171 Infectious disease: bacterial    05132 Salmonella infection     101911124  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fpg04052]     101911124    00536 Glycosaminoglycan binding proteins [BR:fpg00536]     101911124 Cytokines and neuropeptides [BR:fpg04052]  Cytokines   Chemokines    101911124 Glycosaminoglycan binding proteins [BR:fpg00536]  Heparan sulfate / Heparin   Chemokines    101911124 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Ig_J_chain Motif Other DBs NCBI-GeneID:  101911124 NCBI-ProteinID:  XP_005243244 LinkDB All DBs Position Un AA seq 103 aa AA seqDB search MNGKLVAVLALFLISVALSQGRTLARMGTELRCQCVATHSKFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQLIVKAILANAQLNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaaacttgtggctgtcttggctctcttcctgatttcagtggcattgtctcag ggtaggaccctggcaaggatgggaaccgagctccggtgccagtgtgtagccactcattcc aagttcatccctcctaaatccattcaagatgtgaagctgacacagagcggcccccactgc aagaacgttgaagtcatagcgactctgaaggacggcagagaggtgtgcttggagcccact gctccctgggtacagctgatcgtgaaggcaattttggctaatgctcagctcaattcggac tcaccgctctaa

DBGET integrated database retrieval system