Falco peregrinus (peregrine falcon): 101912552 Help Entry 101912552         CDS       T02856                                  Symbol PFN2 Name (RefSeq) profilin 2   KO K05759   profilin Organism fpg  Falco peregrinus (peregrine falcon) Pathway fpg04810   Regulation of actin cytoskeleton fpg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fpg00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101912552 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101912552 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fpg04131]     101912552 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:fpg04812]     101912552 (PFN2)    04147 Exosome [BR:fpg04147]     101912552 (PFN2) Membrane trafficking [BR:fpg04131]  Others   Actin-binding proteins    Others     101912552 (PFN2) Cytoskeleton proteins [BR:fpg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101912552 (PFN2) Exosome [BR:fpg04147]  Exosomal proteins   Proteins found in most exosomes    101912552 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101912552 NCBI-ProteinID:  XP_013151742 LinkDB All DBs Position Un AA seq 91 aa AA seqDB search MIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRV LVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgattgtaggaaaagaccgagagggtttcttcaccaatggtctgacccttggtgcgaag aagtgctctgtgatcagagatagcctgtatgttgacggcgactgcacaatggacatcagg acaaagagtcaaggtggtgagccaacatacaatgttgctgtaggcagagctggccgagtc ttggtctttgtaatgggcaaagaaggggtccatggaggcggattgaataagaaggcatac tcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system