KEGG   Falco peregrinus (peregrine falcon): 101913296
Entry
101913296         CDS       T02856                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101913296 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fpg04050]
    101913296 (TNFRSF8)
   04090 CD molecules [BR:fpg04090]
    101913296 (TNFRSF8)
Cytokine receptors [BR:fpg04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101913296 (TNFRSF8)
CD molecules [BR:fpg04090]
 Proteins
  101913296 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 KIAA1328 MFS_2
Other DBs
NCBI-GeneID: 101913296
NCBI-ProteinID: XP_013155686
LinkDB
Position
Un
AA seq 473 aa
MAACSLAQGLCLLLLLQDIQTAPQTSLAPSHSCDTLENWFYDETSRSCCYKCPSGYVKKK
ACPRDPDEDCMTCGPEQYVNEELGKPQCDACVLCAKESELVEKKPCSFNSSRVCECRPGL
FCQMAVKNTCLRCQQHAVCKPGFGVKVRGTSTNDVTCEECPSGTFSDQSSSTDVCKPHTN
CAKLNKVAVSEGNATHDQVCLDQLPTYLIPSTLSVRFSNETNNSDLRRFEESLVTIASIL
LSATTTENPSSTPEEKALAGLVLWGVVLSVIVLLVGMLLFWKRKVCKKRILILKAKPHLQ
SVSSHKSGLGSQGSDLANKCAVSIILTTDSRPEEEELIDRTLPLETNNNLVSSTEKACGP
HLSLTDLTQSNGNAPDCPIDSRVRDHTNNRIEKIYIMKADTVIVGSVSEVPSGKNCAARG
CESNVDAQESMEEELAMHYPEQETESFPGNDVTVPVEEEGKEFHHPTTATEKW
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggctgcctgcagcctggcacaaggactgtgcctcctactgcttctccaggatatccag
acagccccacagacatcactagccccatctcattcctgtgatacacttgagaattggttc
tatgatgaaacttcacgaagctgctgttacaagtgtccctcaggctatgttaaaaagaaa
gcatgtcctagggacccagatgaggactgcatgacatgtggacctgaacaatatgtgaat
gaagaattaggaaagccacaatgtgacgcttgtgtattatgtgcaaaagagtctgagctc
gtggagaaaaagccctgctccttcaattctagccgcgtgtgtgagtgccgaccaggcttg
ttctgtcaaatggctgtcaagaacacttgcttgcgatgccagcagcacgctgtttgcaag
cctggttttggagtcaaagtcagaggcacctccacaaacgatgttacttgtgaagagtgc
ccttctgggaccttctctgatcaaagttccagcactgacgtctgcaagccccacacaaac
tgtgccaagttaaacaaagtagcagtaagtgaaggaaatgccacacatgatcaggtttgc
ctggaccaattgcccacctacctcatcccaagcactttgtccgtgagattcagcaatgaa
acaaataactctgacctcaggaggtttgaggagagcctggtgaccattgcgagtatcctt
ttaagtgccaccacaactgaaaatcccagttcaactcctgaggagaaagctctggctggt
ctagttctttggggagtggttctctctgtgatagtgctacttgtgggcatgctgttattt
tggaaacggaaggtttgcaagaagcggatcctcattctcaaagcaaagccacatctgcaa
tctgtcagttcacacaaatctgggctcggctctcaaggttctgacctagcaaacaaatgt
gcagtaagtatcatactgactactgacagtaggccagaagaggaggagttaattgacagg
accctccctttggaaacgaacaataacttggtctccagcacagaaaaagcatgtggtcct
cacctgagtctgactgacctgacacagagcaatggaaatgccccagattgccctattgat
tcccgagtgagagaccacacgaataatcgaattgaaaaaatatacatcatgaaggctgac
actgttattgtggggtccgtttcagaagtgcctagtggcaagaactgtgctgctagagga
tgtgaaagtaatgttgatgcccaggaaagcatggaagaggaactggcaatgcactatcca
gagcaggaaacagaatcttttccagggaatgacgtaacggttcctgtggaagaggaagga
aaggaatttcaccaccccaccactgccactgaaaaatggtaa

DBGET integrated database retrieval system