Falco peregrinus (peregrine falcon): 101914441 Help Entry 101914441         CDS       T02856                                  Symbol DYNLL2 Name (RefSeq) dynein light chain LC8-type 2   KO K10418   dynein light chain LC8-type Organism fpg  Falco peregrinus (peregrine falcon) Pathway fpg04814   Motor proteins fpg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fpg00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     101914441 (DYNLL2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101914441 (DYNLL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fpg03037]     101914441 (DYNLL2)    04812 Cytoskeleton proteins [BR:fpg04812]     101914441 (DYNLL2) Cilium and associated proteins [BR:fpg03037]  Motile cilia and associated proteins   Dynein arm    101914441 (DYNLL2) Cytoskeleton proteins [BR:fpg04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101914441 (DYNLL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop AAA_lid_7 Ectatomin Motif Other DBs NCBI-GeneID:  101914441 NCBI-ProteinID:  XP_005233750 LinkDB All DBs Position Un AA seq 96 aa AA seqDB search MFCLRFTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPT WHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgttctgccttaggttcacgatgtctgacagaaaggctgtgatcaagaatgcggacatg tccgaggacatgcagcaagatgctgtagactgtgctacacaggcaatggagaagtacaac atagaaaaggacattgcagcatatataaagaaggaatttgacaagaaatacaacccaact tggcactgcattgttggcagaaactttggcagctatgtaacacacgagacaaagcacttc atctatttttacttgggtcaggttgcaattcttctcttcaagtctggatag

DBGET integrated database retrieval system