Falco peregrinus (peregrine falcon): 101914879 Help Entry 101914879         CDS       T02856                                  Symbol CDC42 Name (RefSeq) cell division cycle 42   KO K04393   cell division control protein 42 Organism fpg  Falco peregrinus (peregrine falcon) Pathway fpg04010   MAPK signaling pathway fpg04144   Endocytosis fpg04370   VEGF signaling pathway fpg04510   Focal adhesion fpg04520   Adherens junction fpg04530   Tight junction fpg04810   Regulation of actin cytoskeleton fpg04912   GnRH signaling pathway fpg05100   Bacterial invasion of epithelial cells fpg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fpg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101914879 (CDC42)    04370 VEGF signaling pathway     101914879 (CDC42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101914879 (CDC42)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101914879 (CDC42)    04520 Adherens junction     101914879 (CDC42)    04530 Tight junction     101914879 (CDC42)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101914879 (CDC42)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     101914879 (CDC42)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101914879 (CDC42)    05100 Bacterial invasion of epithelial cells     101914879 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fpg04131]     101914879 (CDC42)    03036 Chromosome and associated proteins [BR:fpg03036]     101914879 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fpg04147]     101914879 (CDC42)    04031 GTP-binding proteins [BR:fpg04031]     101914879 (CDC42) Membrane trafficking [BR:fpg04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     101914879 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     101914879 (CDC42)   Macropinocytosis    Ras GTPases     101914879 (CDC42) Chromosome and associated proteins [BR:fpg03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     101914879 (CDC42) Exosome [BR:fpg04147]  Exosomal proteins   Exosomal proteins of microglial cells    101914879 (CDC42)   Exosomal proteins of breast milk    101914879 (CDC42) GTP-binding proteins [BR:fpg04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     101914879 (CDC42) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  101914879 NCBI-ProteinID:  XP_005238036 LinkDB All DBs Position Un AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKTRRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacgatcaagtgcgtagtcgtgggtgatggtgctgtcggtaaaacctgtctctta atttcttacacaacaaataaattcccatcggaatatgtaccaacggttttcgataactat gctgtaacagtgatgattggaggagagccttacaccctaggcctctttgatactgcaggt caggaagactatgatagattacgacccctcagctatccacagacagatgtatttctggtc tgtttttcagtggtgtctccttcttcatttgaaaatgtgaaagaaaagtgggtacctgaa attactcaccactgtccaaagactcctttcctgcttgttgggacccagattgatctaaga gatgatccctcaacaattgagaaacttgccaagaataagcagaagcccataactccagag acggctgaaaaactggcccgggacctgaaggctgtcaaatatgtggaatgctctgcactt acgcagaaaggcctaaagaatgtatttgacgaagcgatattggctgccctggagcctccg gagccgaagaagactcgcaggtgtgtgctgctatga

DBGET integrated database retrieval system