Falco peregrinus (peregrine falcon): 101915745 Help Entry 101915745         CDS       T02856                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism fpg  Falco peregrinus (peregrine falcon) Pathway fpg04010   MAPK signaling pathway fpg04068   FoxO signaling pathway fpg04081   Hormone signaling fpg04114   Oocyte meiosis fpg04140   Autophagy - animal fpg04150   mTOR signaling pathway fpg04810   Regulation of actin cytoskeleton fpg04910   Insulin signaling pathway fpg04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:fpg00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     101915745 (INS)    04150 mTOR signaling pathway     101915745 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     101915745 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101915745 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fpg04052]     101915745 (INS) Cytokines and neuropeptides [BR:fpg04052]  Neuropeptides   Unclassified    101915745 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  101915745 NCBI-ProteinID:  XP_005237374 LinkDB All DBs Position Un AA seq 107 aa AA seqDB search MALWIRSLPLLALLTLSGPGTSHAAATQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQ PLVSSPLHGEAGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcgctgcctctcctggcccttctcactctttctggccccggg accagccacgcggctgccacccagcacctctgtggctcccacttggtggaggctctctac ctggtgtgtggagagaggggtttcttctactcccccaaagcccgccgggatgttgagcag cctctagtgagcagtcccttgcacggtgaggccggagagctgcccttccagcaggaggag tttgagaaggtgaagcgagggatcgttgagcaatgctgccacaacacgtgctccctctac caactggaaaactactgcaactag

DBGET integrated database retrieval system