Falco peregrinus (peregrine falcon): 101916165 Help Entry 101916165         CDS       T02856                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism fpg  Falco peregrinus (peregrine falcon) Brite KEGG Orthology (KO) [BR:fpg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fpg03036]     101916165   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fpg04147]     101916165 Chromosome and associated proteins [BR:fpg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101916165 Exosome [BR:fpg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101916165 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  101916165 NCBI-ProteinID:  XP_013161203 LinkDB All DBs Position Un AA seq 94 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcccgtaccaagcagacggctcggaaatctaccggtggcaaggcgccacggaagcaa ctggccaccaaggccgccaggaagagcgcaccctccacgggaggtgtgaagaaaccccat cgctacaggcccggcacggtggccctgcgggagatccggcgataccagaaatccacggag ctgctgatccgcaagctgcccttccagcgcctggtgcgggagatcgctcaggatttcaag accgatttgcgtttccagagcgctgccatcggggctctgcag

DBGET integrated database retrieval system