Falco peregrinus (peregrine falcon): 101916271 Help Entry 101916271         CDS       T02856                                  Symbol CD59 Name (RefSeq) CD59 molecule   KO K04008   CD59 antigen Organism fpg  Falco peregrinus (peregrine falcon) Brite KEGG Orthology (KO) [BR:fpg00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fpg04147]     101916271 (CD59)    04090 CD molecules [BR:fpg04090]     101916271 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fpg00537]     101916271 (CD59) Exosome [BR:fpg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101916271 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    101916271 (CD59)   Exosomal proteins of colorectal cancer cells    101916271 (CD59) CD molecules [BR:fpg04090]  Proteins   101916271 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fpg00537]  Antigens   101916271 (CD59) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  UPAR_LY6 CoV_NSP13_ZBD Motif Other DBs NCBI-GeneID:  101916271 NCBI-ProteinID:  XP_005240405 LinkDB All DBs Position Un AA seq 119 aa AA seqDB search MIKMNCILLTACIILVAFCSSGYALRCYHCENSPSLCKTNSTCLATEDTCVQMKFGKLRT SSCWKASQCSMNDIAEFFQLDNFEFFCCQHDLCNESAITGISKAAFSIASAMTMLWMLL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgatcaagatgaactgcatcctgttaaccgcctgcatcattctggttgctttttgtagt tctggttatgccctaaggtgttaccactgcgagaacagcccttccttgtgcaagaccaac agtacttgcttagcgactgaagacacttgcgtgcagatgaaatttggtaaattgagaacc tcctcctgctggaaggcatcccagtgcagtatgaatgatattgctgaattcttccagttg gataattttgaattcttttgctgccaacacgacttgtgcaatgagagtgcaattactggg attagcaaagcagccttcagtattgcctctgcaatgactatgttatggatgcttctgtaa

DBGET integrated database retrieval system