Falco peregrinus (peregrine falcon): 101916391 Help Entry 101916391         CDS       T02856                                  Symbol JTB Name (RefSeq) jumping translocation breakpoint   KO K28000   protein JTB Organism fpg  Falco peregrinus (peregrine falcon) Brite KEGG Orthology (KO) [BR:fpg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fpg03036]     101916391 (JTB) Chromosome and associated proteins [BR:fpg03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     CPC (chromosomal passenger complex)      101916391 (JTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  JTB Motif Other DBs NCBI-GeneID:  101916391 NCBI-ProteinID:  XP_013160246 LinkDB All DBs Position Un AA seq 79 aa AA seqDB search MKTISQCSPTGFIEKINCATSKRDEYKSCRSAVMEAHVFWRFVGTMMCVATVFAVLVVCR QRVLDRKALEKVRKQIESI NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaaaacaatatcgcagtgcagccccacgggcttcattgagaagatcaactgtgccaca tccaagagagatgagtataagagctgtcgctccgcagtgatggaggcgcatgttttctgg aggttcgtgggtaccatgatgtgcgttgccaccgtcttcgcggtgctggtggtgtgtcgc cagcgcgtgctggacaggaaggccctggagaaggtccgcaagcagatcgagtccatttag

DBGET integrated database retrieval system