Falco peregrinus (peregrine falcon): 101916982 Help Entry 101916982         CDS       T02856                                  Symbol HRAS Name (RefSeq) HRas proto-oncogene, GTPase   KO K02833   GTPase HRas Organism fpg  Falco peregrinus (peregrine falcon) Pathway fpg04010   MAPK signaling pathway fpg04012   ErbB signaling pathway fpg04068   FoxO signaling pathway fpg04137   Mitophagy - animal fpg04140   Autophagy - animal fpg04144   Endocytosis fpg04150   mTOR signaling pathway fpg04210   Apoptosis fpg04218   Cellular senescence fpg04370   VEGF signaling pathway fpg04371   Apelin signaling pathway fpg04510   Focal adhesion fpg04519   Cadherin signaling fpg04540   Gap junction fpg04625   C-type lectin receptor signaling pathway fpg04810   Regulation of actin cytoskeleton fpg04910   Insulin signaling pathway fpg04912   GnRH signaling pathway fpg04916   Melanogenesis fpg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fpg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101916982 (HRAS)    04012 ErbB signaling pathway     101916982 (HRAS)    04370 VEGF signaling pathway     101916982 (HRAS)    04371 Apelin signaling pathway     101916982 (HRAS)    04068 FoxO signaling pathway     101916982 (HRAS)    04150 mTOR signaling pathway     101916982 (HRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     101916982 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101916982 (HRAS)    04140 Autophagy - animal     101916982 (HRAS)    04137 Mitophagy - animal     101916982 (HRAS)   09143 Cell growth and death    04210 Apoptosis     101916982 (HRAS)    04218 Cellular senescence     101916982 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101916982 (HRAS)    04540 Gap junction     101916982 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101916982 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101916982 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101916982 (HRAS)    04912 GnRH signaling pathway     101916982 (HRAS)    04916 Melanogenesis     101916982 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101916982 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fpg04131]     101916982 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fpg04147]     101916982 (HRAS)    04031 GTP-binding proteins [BR:fpg04031]     101916982 (HRAS) Membrane trafficking [BR:fpg04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101916982 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     101916982 (HRAS) Exosome [BR:fpg04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101916982 (HRAS)   Exosomal proteins of colorectal cancer cells    101916982 (HRAS) GTP-binding proteins [BR:fpg04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101916982 (HRAS) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  101916982 NCBI-ProteinID:  XP_013153694 LinkDB All DBs Position Un AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggagctggtggtgtcgggaagagtgctttgacg atacagctcattcagaaccatttcgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtcgtcatcgatggagagacctgcttgttagacatcttggataccgcaggg caggaagagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctctgc gtcttcgccatcaataacaccaagtcctttgaagacattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgacctg ccagcccggacagtggagacccggcaagcgcaggacctggcccggagttacgggatcccc tacatagaaacctctgccaaaaccagacagggcgttgaagatgccttctacaccttggtg cgggagatccggcagcacaagctgcgcaaactgaatcccccagacgagagcggccccggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system