Falco peregrinus (peregrine falcon): 101922275 Help Entry 101922275         CDS       T02856                                  Symbol ARF5 Name (RefSeq) ADP ribosylation factor 5   KO K07940   ADP-ribosylation factor 5 Organism fpg  Falco peregrinus (peregrine falcon) Pathway fpg04144   Endocytosis Brite KEGG Orthology (KO) [BR:fpg00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101922275 (ARF5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fpg04131]     101922275 (ARF5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fpg04147]     101922275 (ARF5)    04031 GTP-binding proteins [BR:fpg04031]     101922275 (ARF5) Membrane trafficking [BR:fpg04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     101922275 (ARF5) Exosome [BR:fpg04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101922275 (ARF5)   Exosomal proteins of colorectal cancer cells    101922275 (ARF5) GTP-binding proteins [BR:fpg04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     101922275 (ARF5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc Ras SRPRB G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU RXYLT1_N Csa3_N Motif Other DBs NCBI-GeneID:  101922275 NCBI-ProteinID:  XP_005243551 LinkDB All DBs Position Un AA seq 163 aa AA seqDB search HLFVAVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPL WRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMAVS ELTDKLGLQTLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR NT seq 492 nt NT seq  +upstreamnt  +downstreamnt cacctcttcgttgcagtgggcctagatgccgccggcaagaccaccatcctctacaagctg aagctgggtgagatcgtcaccaccatccccaccatcgggttcaacgtggagacagtggag tacaagaacatttgtttcactgtatgggatgtgggtggccaagacaaaatccgacccctc tggaggcactacttccaaaacacgcagggtctcatcttcgtggtggacagcaatgaccga gagcgagtgcaggagtctgccgatgagttgcagaagatgctgcaggaggatgagctgcgg gatgccgtcttgctggtgtttgccaacaagcaggatatgcccaacgccatggcagtgagc gagctgactgacaagctggggctgcagacgctgcgcagcaggacctggtatgtgcaggca acgtgtgcgacccagggcacggggctctacgacgggctggactggctatcgcatgagctc tccaagcgctag

DBGET integrated database retrieval system