Falco peregrinus (peregrine falcon): 101923298 Help Entry 101923298         CDS       T02856                                  Symbol CLDN19 Name (RefSeq) claudin 19   KO K06087   claudin Organism fpg  Falco peregrinus (peregrine falcon) Pathway fpg03272   Virion - Hepatitis viruses fpg04382   Cornified envelope formation fpg04514   Cell adhesion molecule (CAM) interaction fpg04530   Tight junction Brite KEGG Orthology (KO) [BR:fpg00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     101923298 (CLDN19)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     101923298 (CLDN19)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     101923298 (CLDN19)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     101923298 (CLDN19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fpg03037]     101923298 (CLDN19)    04147 Exosome [BR:fpg04147]     101923298 (CLDN19) Cilium and associated proteins [BR:fpg03037]  Other cilia and associated proteins   Stereociliary proteins    101923298 (CLDN19) Exosome [BR:fpg04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    101923298 (CLDN19)   Exosomal proteins of colorectal cancer cells    101923298 (CLDN19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF7702 TMEM37 DUF981 SK_channel Motif Other DBs NCBI-GeneID:  101923298 NCBI-ProteinID:  XP_005238081 LinkDB All DBs Position Un AA seq 169 aa AA seqDB search LPHWRQSSYAGDAIITAVGLHQGLWMSCAAQSTGQVQCRLHDSLFSLSVHIQISRALMVI SLLLGFFGIIVSVVGMKCTKVGEEDPVTKSRIAVAGGILFILSGLCTLIAVSYYAMQVAH EFFDKNPFPANASAKEQRGWSSYRQSQPSTAREPPVKMSSSPIRGEQCL NT seq 510 nt NT seq  +upstreamnt  +downstreamnt ctgccgcactggcggcagagctcctacgccggggacgccatcatcacggccgtggggctg caccaggggctgtggatgagctgcgccgcccagagcaccgggcaggtccagtgccgcctg cacgactcgctgttctccctcagcgttcacatccagatctcccgggctctcatggtgatt tctctcctcctgggtttcttcggcatcattgtcagcgtggtgggcatgaaatgcaccaaa gttggtgaagaggatcctgtcaccaagagccgcatcgctgtggctggaggcatcctcttc atcctctccggtctgtgcaccttgatcgccgtgtcctactacgccatgcaggtggcccac gagttcttcgacaagaaccccttccccgccaacgccagcgccaaggagcagcgagggtgg tccagctatcggcagtcgcagccttcgacggctcgggaaccccctgtaaaaatgtcttct tcacccatcaggggagagcagtgcttatag

DBGET integrated database retrieval system