Ferroglobus placidus: Ferp_1991 Help Entry Ferp_1991         CDS       T01172                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism fpl  Ferroglobus placidus Pathway fpl03010   Ribosome Brite KEGG Orthology (KO) [BR:fpl00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Ferp_1991   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Ferp_1991  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:fpl03011]     Ferp_1991    04121 Ubiquitin system [BR:fpl04121]     Ferp_1991 Ribosome [BR:fpl03011]  Ribosomal proteins   Eukaryotes    Large subunit     Ferp_1991   Archaea     Ferp_1991 Ubiquitin system [BR:fpl04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Ferp_1991 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_Ribbon_1 DZR Ribosomal_L40e DZR_2 Zn_ribbon_RPAB4 DUF6079_6th zf-ZTF2_1 HVO_0416 DUF6395 Motif Other DBs NCBI-ProteinID:  ADC66128 UniProt:  D3S065 LinkDB All DBs Position 1724974..1725126 Genome browser AA seq 50 aa AA seqDB search MARFPEAEARLFNVKICMRCNARNPMKARTCRKCGYKGLRPKAKERKGRK NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atggcgagatttccagaggctgaagcgaggctattcaacgtgaaaatctgcatgaggtgc aacgcaagaaatccgatgaaagcgagaacttgcagaaagtgcggatacaaaggtttgaga cctaaagccaaagaaagaaagggtaggaagtaa

DBGET integrated database retrieval system