Flavonifractor plautii: A4U99_11835 Help Entry A4U99_11835       CDS       T04429                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fpla  Flavonifractor plautii Pathway fpla01100   Metabolic pathways fpla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fpla00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A4U99_11835    00074 Mycolic acid biosynthesis     A4U99_11835   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A4U99_11835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ANU41712 UniProt:  A0A174UE73 LinkDB All DBs Position 2447087..2447317 Genome browser AA seq 76 aa AA seqDB search MDFEKVKEIIVETLSCDADKVTPDARLAEDLEADSLAAVELSMALEEEFGVTIADEELPN MKTVGDLVKYLEDHAE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggattttgagaaggttaaagagattattgtggagaccctgagctgcgacgccgacaag gtgacccccgatgcccgcctggcggaggatctggaggccgattccctggccgccgtggag ctgtccatggctctggaggaggagttcggtgtgaccattgccgacgaggagctgcccaac atgaagactgtgggcgacctggtgaagtacctggaggaccacgctgagtaa

DBGET integrated database retrieval system