Flavonifractor plautii: A4U99_12790 Help Entry A4U99_12790       CDS       T04429                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fpla  Flavonifractor plautii Pathway fpla01100   Metabolic pathways fpla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fpla00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A4U99_12790    00074 Mycolic acid biosynthesis     A4U99_12790   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A4U99_12790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ANU41883 UniProt:  A0A174V489 LinkDB All DBs Position complement(2638688..2638921) Genome browser AA seq 77 aa AA seqDB search MIFEKLAALLSEQFGVDVDSITMDTSFEDLGADSLDIVEMTMAVEEEFGLEDMDEEDLSG ISTVADLVRYLKSKLED NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgattttcgagaagctcgccgccctgctgtccgaacagttcggcgtggacgtggacagc attaccatggacacctcgtttgaggatctgggggccgactccctggacatcgtggagatg accatggccgtggaagaggagtttggcctggaggacatggacgaggaggatctgtccggt atctccaccgtggcggatctggtccgctacctcaagtctaagctggaggactga

DBGET integrated database retrieval system