Flavobacterium psychrophilum FPG3: FPG3_12355 Help Entry FPG3_12355        CDS       T03296                                  Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism fpo  Flavobacterium psychrophilum FPG3 Pathway fpo00190   Oxidative phosphorylation fpo01100   Metabolic pathways Module fpo_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:fpo00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FPG3_12355  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:fpo00194]     FPG3_12355 Photosynthesis proteins [BR:fpo00194]  Photosystem and electron transport system   F-type ATPase [OT]    FPG3_12355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C TctB MS_channel_1st_1 Motif Other DBs NCBI-ProteinID:  AIN75000 LinkDB All DBs Position complement(2687032..2687232) Genome browser AA seq 66 aa AA seqDB search MMGTIPNLVGAGLIVIGASLGIGRIGGSAMDAIARQPEASGKIQTAMLIAAALIEGIGFA AFFMGK NT seq 201 nt NT seq  +upstreamnt  +downstreamnt attatgggaactattccaaatttagtaggagcaggtttaatcgttatcggtgctagttta ggtattggtagaattggtggttcagcaatggacgctatagcacgtcaaccagaagcttct ggaaaaattcaaactgcaatgcttatcgcagctgcacttattgaaggtattggttttgct gcattctttatgggcaaataa

DBGET integrated database retrieval system