Fusarium poae: FPOAC1_005006 Help Entry FPOAC1_005006     CDS       T09519                                  Symbol RAC1 Name (RefSeq) Rho GTPase protein rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism fpoa  Fusarium poae Pathway fpoa04145   Phagosome fpoa04148   Efferocytosis fpoa04620   Toll-like receptor signaling pathway fpoa05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:fpoa00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     FPOAC1_005006 (RAC1)    04148 Efferocytosis     FPOAC1_005006 (RAC1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     FPOAC1_005006 (RAC1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     FPOAC1_005006 (RAC1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fpoa04131]     FPOAC1_005006 (RAC1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fpoa04147]     FPOAC1_005006 (RAC1)    04031 GTP-binding proteins [BR:fpoa04031]     FPOAC1_005006 (RAC1) Membrane trafficking [BR:fpoa04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     FPOAC1_005006 (RAC1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     FPOAC1_005006 (RAC1)   Macropinocytosis    Ras GTPases     FPOAC1_005006 (RAC1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     FPOAC1_005006 (RAC1) Exosome [BR:fpoa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    FPOAC1_005006 (RAC1)   Exosomal proteins of other body fluids (saliva and urine)    FPOAC1_005006 (RAC1)   Exosomal proteins of colorectal cancer cells    FPOAC1_005006 (RAC1)   Exosomal proteins of bladder cancer cells    FPOAC1_005006 (RAC1) GTP-binding proteins [BR:fpoa04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     FPOAC1_005006 (RAC1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  68340009 NCBI-ProteinID:  XP_044708248 LinkDB All DBs Position 2:complement(3362066..3362908) Genome browser AA seq 199 aa AA seqDB search MAQPGVQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVMVDGKPISLGL WDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKAKWYPEIDHHAPNIPIILVGT KLDLREDASTLESLRQKRMEPVSYEQALTCAKEIKAYKYLECSALTQRNLKSVFDEAIRA VLNPRPTPSKQKKNKCSIL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atggcccagcccggcgtgcaatcattgaagtgtgtggtgactggtgatggtgctgttgga aagacttgtctactcatttcctacaccacaaatgcgttccccggcgaatacatccctacg gtctttgacaactactctgctagcgttatggtcgatggcaagcctattagtcttggtctc tgggatactgctggtcaggaggattacgacagactgcgacccctttcataccctcagacc gacgtcttcctcatctgcttctccatcgttagccctccatcattcgacaacgtaaaggca aagtggtaccccgagatcgaccatcatgcgcccaacattcccatcattcttgtcggaacc aagctcgatcttcgagaggacgcatccaccctcgaatctctccgacagaagcgcatggag cctgtatcatatgagcaggcgctgacttgcgccaaggagatcaaggcctacaagtacctc gagtgttctgctttgactcaaagaaaccttaagagcgtttttgatgaagctatccgggcc gtcctcaaccctcgacccacaccttcgaagcaaaagaagaacaagtgctctattctgtag

DBGET integrated database retrieval system