Fusarium poae: FPOAC1_005024 Help Entry FPOAC1_005024     CDS       T09519                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism fpoa  Fusarium poae Pathway fpoa03060   Protein export fpoa04141   Protein processing in endoplasmic reticulum fpoa04145   Phagosome Brite KEGG Orthology (KO) [BR:fpoa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     FPOAC1_005024    04141 Protein processing in endoplasmic reticulum     FPOAC1_005024  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     FPOAC1_005024  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fpoa04131]     FPOAC1_005024   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:fpoa02044]     FPOAC1_005024 Membrane trafficking [BR:fpoa04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     FPOAC1_005024 Secretion system [BR:fpoa02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    FPOAC1_005024 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  68340027 NCBI-ProteinID:  XP_044708265 LinkDB All DBs Position 2:3396995..3397316 Genome browser AA seq 70 aa AA seqDB search MSDQVQEILEVPSEFVRDGVQFVRRCTKPDQKEFLRLCQAVGVGFLIMGAVGYVVKLVHI PLNHALVGSA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccgaccaggttcaagagattctcgaggttccctccgagttcgtcagagacggtgtt caattcgtgcgacgatgcactaagcccgaccagaaggagttcctgcgactctgccaagct gttggagttggtttcctcattatgggcgccgtcggttacgtcgtcaagctggtgcacatt cccctcaaccacgccctcgtcggtagcgcataa

DBGET integrated database retrieval system